PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 537aa    MW: 58942.2 Da    PI: 7.0105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0631genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.3e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  l+d+v+ +G g+W+++ +  g+ R++k+c++rw ++l
      Gh_A01G0631 32 KGPWTAAEDAVLADYVRTHGEGNWNAVQKNTGLARCGKSCRLRWANHL 79
                     79******************************************9986 PP

2Myb_DNA-binding49.21.2e-1585128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++v++++++G++ W++ a  ++ gRt++++k++w++
      Gh_A01G0631  85 KGAFSPEEERIIVELHAKMGNK-WARMATQLP-GRTDNEIKNYWNT 128
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1582779IPR017930Myb domain
SuperFamilySSF466891.17E-2831126IPR009057Homeodomain-like
SMARTSM007177.3E-123181IPR001005SANT/Myb domain
PfamPF002496.3E-143279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-233386IPR009057Homeodomain-like
CDDcd001678.65E-103479No hitNo description
PROSITE profilePS5129425.56780134IPR017930Myb domain
SMARTSM007178.2E-1684132IPR001005SANT/Myb domain
PfamPF002491.9E-1485128IPR001005SANT/Myb domain
CDDcd001673.16E-1187128No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2587133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MMMMGGNNQI TTQNEGGGSN NGGGEGGIML KKGPWTAAED AVLADYVRTH GEGNWNAVQK  60
NTGLARCGKS CRLRWANHLR PNLKKGAFSP EEERIIVELH AKMGNKWARM ATQLPGRTDN  120
EIKNYWNTRV KRRQRQGLPL YPPEIQPLYS QHQRNQHRSL PSTPLASPTA TSTSSFSFQT  180
PPNPSSSTTL HGLILTPAHP LHIPRSASSH VLYNPQTPPP LHSASAVSTP CPSPLPSSSP  240
STPTPVSPLQ SPHKPAFSTL PLFDSSTSNT CNNNINANNA INNNTFPSDF FFPRATPPLQ  300
TPMRYKRFRP DVSESINNER HNNSISVNGG CNSTSSSFMS QYPPFQKTSF FNSHATLNVT  360
TSTPLTSPHY SPSYTLDPVT LDLASSSRIL ADHQNFDNGQ FISTPGFDYT PKTDELPSNQ  420
FVSLDGTSEV TFDTKGNCNY ISNDQNNHHQ DLSIHFGGGG LLDDMLEEAQ LLAGDNYILR  480
RESCLDGFNT SSDGLTSGKE ETVTDQEINA TQEEYSRLLN AIPSSMPMPD WYNNCGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31301335107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5787036e-95JX578703.1 Gossypium hirsutum clone NBRI_GE10781 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460804.10.0PREDICTED: myb-like protein A
TrEMBLA0A0D2M8I70.0A0A0D2M8I7_G
STRINGAT4G26930.15e-76(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.24e-70myb domain protein 101